PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G35240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HB-other
Protein Properties Length: 1950aa    MW: 218078 Da    PI: 5.2932
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G35240.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.71.8e-17153207357
                   --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
      Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                   kR   +++qle+Le+ ++ ++yps++ r+eL++k+gL++rq ++WF+ rR k++k
  OB01G35240.1 153 KRMMKSPYQLEVLEKTYAVEQYPSETLRAELSAKIGLSDRQLQMWFCHRRLKDRK 207
                   788999***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.98E-16140207IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-16141207IPR009057Homeodomain-like
PROSITE profilePS5007115.888148208IPR001356Homeobox domain
SMARTSM003891.3E-15150212IPR001356Homeobox domain
CDDcd000861.49E-13153208No hitNo description
PfamPF000463.1E-15153207IPR001356Homeobox domain
SMARTSM005711.7E-14728787IPR018501DDT domain
PROSITE profilePS5082714.537728787IPR018501DDT domain
PfamPF027911.7E-13730784IPR018501DDT domain
PfamPF050661.6E-15904972IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156121.2E-911291171IPR028942WHIM1 domain
PfamPF156134.8E-1213061378IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1950 aa     Download sequence    Send to blast
MDDGDGAAGK AXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  60
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  120
XXXXXXXXXX GAAAGPVSAG SAGASGSSEK PVKRMMKSPY QLEVLEKTYA VEQYPSETLR  180
AELSAKIGLS DRQLQMWFCH RRLKDRKPPT KRQRREEEAA AGPLMAPPPV LPPPTLPLAS  240
GELLISGSSP YDEPPPMPPV HSRRGAGRSS AVPRLSAPDI GRRYYEPLPV MIPPPMSSMQ  300
LTTSELRVIH SVESQLGEPL REDGPVLGIE FDPLPPGSFG APIVPEQPKQ PVRSYDTKIY  360
SRHDSKLLKG SAFFPSVEHP FVPNSIGGKR KLMVGNPPPV HPHAGSRAVH EYQFLPEQPS  420
DRYEGSSRSR YYDMPVEASN SRMSSHTPGS QLLHGSEEAA LGYPFQGQIS GSGLLPQSGR  480
PEVLPAVPTD YEMIQSNSNL NSVPVEGQYG ISQVAGFENS LLPSERRAYH DEDGSRVDRK  540
RKHNEEAKIA KEVEAHEKRI RKELEKQDMM KRKREEQMRK EMERHDRERR KEEERLLRER  600
QREQERFQRE QRREHERMEK FMQKQSRRAE KQRQKEELRK EKEAARQKAA NERATARRIA  660
REYMELVEDE RLELMELAAQ SKGLPSMLYL DSDTLQQLDS FRGMLSPFPP EVVRLKVPFS  720
IKPWTVSEDN VGNLLMVWKF SITFADFLGL SSVTLDEFIQ SLHDYDSRFL GELHIALLKS  780
IIKDIEDVSR TPSVALGVNP GGGHPQIVEG AYAWGFNIRS WQRHLNVLTW PEILRQFALS  840
AGLGPQLKKR DAEGVYSRDD NEGHDGKNVI STLRNGSAAV NAAALMKERG YTHRRRSRHR  900
LTPGTVKFAA FHVLSLEGSK GLTILEVAER IQKSGLRDLT TSKTPEASIA AALSRDTKLF  960
ERTAPSTYCV KSPYRKDPVD SEVVLSSARE KIRAFHNVLS DSEAEKEADG AERDEDSECD  1020
DADADDDPDG DDVNIDVGDG KDPLIGLKEQ DGVPITTAVD STKREEEIEG ALTQPSSLNK  1080
SGKEVLNPSL DKPSSANTSS DSPVRDSSDC HEIAPSDAED QEIDESNQGE SWVQGLAEGD  1140
YCDLSVEERL NALVALVGIA NEGNSIRAVL EERLESANAL KKQMWAEAQH DKRRTKEEFA  1200
SRVQYNSNMN LKADVNQENG TESTTTPCRN VDKDNDGNAG VVNNNNEIID HNSNAVNTSY  1260
ERNGSGQDIT ATADTLSVQQ YAYADKTRSQ LRSYIGHRAE QLFVYRSLPL GQDRRRNRYW  1320
QFSTSASPND PGSGRIFFES RDGYWRVLDS GEAFDSLVAS LDTRGSREAQ LHSMLQRIEP  1380
TFKEAIKRKN GAVVEQSAGR YLKNGAMEMI RASSRSEFGS PSSSLSGITS DSAIAFSDSF  1440
KIELGRNDVE KTAISKRADG FIRWMWRECN DLKLTCTMKC GKKRCSELIH SCTYCYQIYL  1500
AEERHCSSCH MIFKSIHNFS DHTSQCEEKR RTDHNWKMQT ADHSIPVGMR LLKLQLSTIE  1560
ASIPPEAIQP FWTDGYRKSW GVKLHSTASL EELFQMLTLL EGAIKRDYLS SDFETTKELL  1620
NLNTQDTASQ NHVGLSGSAA VLPWVPATTA AIALRMLDLD SAVSYIQNQK MERDGGDFVK  1680
PPSRFAVVKN AQELEPLEAT GFDLYDGRWV AGSGRRGRGR GSRGGGSRGG RGRSRGGRVP  1740
RGISSSSRIG FKDENESSRK NARRGRTTRG RRRGRRTVRP RQPSEGRGRS IPKENLLGSF  1800
SMLSNAKPAT VEESPRSSGA DEWGLDNRRP YIEGDENSSG SQSDQSEDNE ENGQPMDEEY  1860
DEQVPNYSRG YSGGSRPHGM IDDESEEEDE DAEGDDDGEE DDVDHAVDDV DAEMDDDDDI  1920
GDDGEDGGDG GEANADEDEG ASSYSSEYSD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1071290.0AK107129.1 Oryza sativa Japonica Group cDNA clone:002-124-C03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006644502.20.0PREDICTED: homeobox-DDT domain protein RLT2-like
TrEMBLJ3L2R80.0J3L2R8_ORYBR; Uncharacterized protein
STRINGOB01G35240.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22833352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator